PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G262900.1
Common NamePHAVU_008G262900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 305aa    MW: 34394.3 Da    PI: 9.607
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G262900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.52e-103074345
                        SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                        +WT+eE +l+ +a + + ++   +W+++a++++ g+t  +++  + 
  Phvul.008G262900.1 30 KWTPEENKLFENALAVHDKDtpdRWHKVAEMIP-GKTVVDVIKQYK 74
                        8********************************.******998886 PP

2Myb_DNA-binding445.1e-14135179347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + k++G+g+W+ I+r    +Rt+ q+ s+ qky
  Phvul.008G262900.1 135 PWTEEEHKLFLLGLKKYGKGDWRNISRNYVITRTPTQVASHAQKY 179
                         8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.2832681IPR017884SANT domain
SMARTSM007176.9E-112779IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-52775IPR009057Homeodomain-like
SuperFamilySSF466894.6E-122981IPR009057Homeodomain-like
CDDcd001674.37E-93076No hitNo description
PfamPF002494.7E-93075IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-12127184IPR009057Homeodomain-like
PROSITE profilePS5129420.5128184IPR017930Myb domain
SuperFamilySSF466891.0E-16129183IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-17131183IPR006447Myb domain, plants
SMARTSM007171.1E-12132182IPR001005SANT/Myb domain
CDDcd001678.59E-11135180No hitNo description
PfamPF002491.5E-12135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MKWETVALSP TPCSPNSNTN WLVENNRSTK WTPEENKLFE NALAVHDKDT PDRWHKVAEM  60
IPGKTVVDVI KQYKELEVDV SNIEAGLIPV PGYSTATSPF TLDWVNTPGY DGFKGSGKRS  120
SSVRPHEQER KKGVPWTEEE HKLFLLGLKK YGKGDWRNIS RNYVITRTPT QVASHAQKYF  180
IRQLSGGKDK RRASIHDITT VNLTETTTSS SEDTNRSTSP HVLSQQQQPN STPTTPRTHF  240
QWSNQSSTGV AMTFNPVHER VFMSPYGANS FGVKMEGRNL HNESSYLGPQ TQNMVFQMQQ  300
SSQH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1631951175RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142227.10.0hypothetical protein PHAVU_008G262900g
SwissprotQ8S9H71e-118DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV7BCN70.0V7BCN7_PHAVU; Uncharacterized protein
STRINGGLYMA14G37050.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-84MYB family protein